PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000204495
Common NameLOC103407463
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 343aa    MW: 37974.2 Da    PI: 4.8936
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000204495genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-142673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
    MDP0000204495 26 KGLWSPEEDDKLMRYMINNGQGCWSDVARNAGLQRCGKSCRLRWINYL 73
                     678*******************************************97 PP

2Myb_DNA-binding47.93.1e-1579122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++ ++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
    MDP0000204495  79 RGAFLPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 122
                      78999*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-222075IPR009057Homeodomain-like
PROSITE profilePS5129416.7062173IPR017930Myb domain
SuperFamilySSF466892.62E-2724120IPR009057Homeodomain-like
SMARTSM007172.0E-102575IPR001005SANT/Myb domain
PfamPF002492.0E-132673IPR001005SANT/Myb domain
CDDcd001673.91E-92973No hitNo description
PROSITE profilePS5129425.14374128IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-2576129IPR009057Homeodomain-like
SMARTSM007179.5E-1578126IPR001005SANT/Myb domain
PfamPF002494.8E-1479122IPR001005SANT/Myb domain
CDDcd001671.44E-1081121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MRKPEPSSAA AGKNNKENNS NSKLRKGLWS PEEDDKLMRY MINNGQGCWS DVARNAGLQR  60
CGKSCRLRWI NYLRPDLKRG AFLPQEEELI IHLHSLLGNR WSQIAARLPG RTDNEIKNFW  120
NSTIKKRLKN LSSSNGSPNT SDSSPEAKDH RVVAASRFII PGQEHGMVPI YMDSTSSFMQ  180
SAVLSHMFDP FPALDIDQGG LTLPGAGGYY NANPCITQRE IGVGGGDDCY NFGGNGGFGS  240
GDVDIGVEGE IFVPPLESVS IEDQNIKTET TYGDSKNNNI YYNNINSILT CNKTNKNIKG  300
ESIIGVGNYF DDDQEELTMG DWDLEDLMKD VSSSSFPFLD YQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27241285108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159920.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744680.0DQ074468.1 Malus x domestica MYB20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306942.10.0transcription factor MYB46-like
SwissprotQ9LXV27e-71MYB46_ARATH; Transcription factor MYB46
TrEMBLQ2LME40.0Q2LME4_MALDO; MYB20
STRINGGLYMA12G06180.21e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-58myb domain protein 46
Publications ? help Back to Top
  1. Hellens RP, et al.
    Transient expression vectors for functional genomics, quantification of promoter activity and RNA silencing in plants.
    Plant Methods, 2005. 1: p. 13
    [PMID:16359558]